PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA3276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 130aa    MW: 14811.6 Da    PI: 6.514
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA3276genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.41.2e-5421116297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               +eqdr+lPianv+rimk++lP+nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++walatlGf+dy+ep++ y
  Tp57577_TGAC_v2_mRNA3276  21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALATLGFDDYAEPMRRY 105
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l++yrele ++
  Tp57577_TGAC_v2_mRNA3276 106 LHRYRELEVDR 116
                               ********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.2E-5117123IPR009072Histone-fold
SuperFamilySSF471133.11E-3823120IPR009072Histone-fold
PfamPF008082.4E-272690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.6E-195472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.6E-197391No hitNo description
PRINTSPR006157.6E-1992110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MVDNNVGGSC SNYNENGGII KEQDRLLPIA NVGRIMKQIL PQNAKISKES KETMQECVSE  60
FISFVTSEAS EKCRKERRKT VNGDDICWAL ATLGFDDYAE PMRRYLHRYR ELEVDRTPNN  120
NHNVQDRGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4520111192Transcription factor HapC (Eurofung)
4g92_B3e-4520111192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743711e-139AC174371.23 Medicago truncatula chromosome 8 clone mth2-50f21, complete sequence.
GenBankBT1370511e-139BT137051.1 Medicago truncatula clone JCVI-FLMt-1H17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609646.23e-84nuclear transcription factor Y protein
SwissprotO822481e-56NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLG7JKC33e-84G7JKC3_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA17G02810.14e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-58nuclear factor Y, subunit B5